PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G036702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NAC
Protein Properties Length: 497aa    MW: 55466 Da    PI: 6.3088
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G036702.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM129.82e-40121401128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           +p+G+rF+Pt+ee++++y+k k +g +  ++ v+++vd + ++PwdLp  +++k++++ w+fF++rd ky+++kr+nr+tk+gyWk tg
  HL.SW.v1.0.G036702.1  12 VPVGYRFSPTEEEVISHYMKLKNQGVNAMVDPVMATVDFCAFDPWDLPpkSMIKSSDQVWWFFCPRDYKYNNSKRSNRKTKTGYWKITG 100
                           599************************999889**************87448888999******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           k ++++s+kg  +g k++Lvfykg  p g+ t+Wvmhey++
  HL.SW.v1.0.G036702.1 101 KGQKIKSTKGVIIGGKRILVFYKGPCP-GQGTEWVMHEYHF 140
                           **********************88776.599********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-467160IPR003441NAC domain
PROSITE profilePS5100545.66712160IPR003441NAC domain
PfamPF023651.6E-2213139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MSSSAVVLPK NVPVGYRFSP TEEEVISHYM KLKNQGVNAM VDPVMATVDF CAFDPWDLPP  60
KSMIKSSDQV WWFFCPRDYK YNNSKRSNRK TKTGYWKITG KGQKIKSTKG VIIGGKRILV  120
FYKGPCPGQG TEWVMHEYHF EPENANPNQK SYVVCRLERK TDEKGPKTTS PDYETGQPSG  180
ESSPDGEYRL PSSAIPEYQL FCDTNNQVNL DSFFPHRNAQ NAHDFLNEIQ VSFSGDEAVD  240
VDFADSLIVE PEECHYGATT KRYSLDGADS SETDDEWIRQ AVGSHDNSKR VRHLQMNRTP  300
SETFHTYSGG NVVEETIVSG QFSEEDTSSD DFTPGGGIKI KPLDLGSVGI RQFTTGRNNV  360
IHFNEGDVPI RGGVHHTRVQ PPKKVSIVAV PGNKVPEAGK HSITHICSPK KEKSTEESEN  420
LRKTAHCSSS VERHFELQAE CESTVSSKLK SFFTFEETSS VLSCDTTPPS VYVLNTVVGV  480
VLFLVFLREL VLFGSW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-311116314171Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.12e-45NAC 014